Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for heather-1 41. heather-1 Lv 1 27 pts. 10,607
  2. Avatar for Zosa 42. Zosa Lv 1 26 pts. 10,599
  3. Avatar for Oransche 43. Oransche Lv 1 25 pts. 10,463
  4. Avatar for Hellcat6 44. Hellcat6 Lv 1 24 pts. 10,309
  5. Avatar for AlkiP0Ps 45. AlkiP0Ps Lv 1 24 pts. 10,255
  6. Avatar for Blipperman 46. Blipperman Lv 1 23 pts. 10,253
  7. Avatar for dizzywings 47. dizzywings Lv 1 22 pts. 10,156
  8. Avatar for Merf 48. Merf Lv 1 21 pts. 10,136
  9. Avatar for Deleted player 49. Deleted player 20 pts. 10,082
  10. Avatar for cjddig 50. cjddig Lv 1 19 pts. 10,050

Comments