Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for jausmh 51. jausmh Lv 1 19 pts. 10,039
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 18 pts. 10,023
  3. Avatar for SirWill3 53. SirWill3 Lv 1 17 pts. 10,018
  4. Avatar for Trajan464 54. Trajan464 Lv 1 17 pts. 9,984
  5. Avatar for Dr.Sillem 55. Dr.Sillem Lv 1 16 pts. 9,928
  6. Avatar for Beany 56. Beany Lv 1 15 pts. 9,919
  7. Avatar for Arne Heessels 57. Arne Heessels Lv 1 15 pts. 9,914
  8. Avatar for Visok 58. Visok Lv 1 14 pts. 9,901
  9. Avatar for kevin everington 59. kevin everington Lv 1 13 pts. 9,853
  10. Avatar for rezaefar 60. rezaefar Lv 1 13 pts. 9,816

Comments