Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for jausmh 51. jausmh Lv 1 19 pts. 10,039
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 18 pts. 10,023
  3. Avatar for SirWill3 53. SirWill3 Lv 1 17 pts. 10,018
  4. Avatar for Trajan464 54. Trajan464 Lv 1 17 pts. 9,984
  5. Avatar for Dr.Sillem 55. Dr.Sillem Lv 1 16 pts. 9,928
  6. Avatar for Beany 56. Beany Lv 1 15 pts. 9,919
  7. Avatar for Arne Heessels 57. Arne Heessels Lv 1 15 pts. 9,914
  8. Avatar for Visok 58. Visok Lv 1 14 pts. 9,901
  9. Avatar for kevin everington 59. kevin everington Lv 1 13 pts. 9,853
  10. Avatar for rezaefar 60. rezaefar Lv 1 13 pts. 9,816

Comments