Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for PeterDav 61. PeterDav Lv 1 12 pts. 9,783
  2. Avatar for wosser1 62. wosser1 Lv 1 12 pts. 9,727
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 11 pts. 9,673
  4. Avatar for j.wohlmann 64. j.wohlmann Lv 1 11 pts. 9,632
  5. Avatar for carxo 65. carxo Lv 1 10 pts. 9,611
  6. Avatar for frostschutz 66. frostschutz Lv 1 10 pts. 9,585
  7. Avatar for zackallen 67. zackallen Lv 1 10 pts. 9,575
  8. Avatar for Larini 68. Larini Lv 1 9 pts. 9,554
  9. Avatar for Sciren 69. Sciren Lv 1 9 pts. 9,515
  10. Avatar for TokyoTF 70. TokyoTF Lv 1 8 pts. 9,514

Comments