Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for PeterDav 61. PeterDav Lv 1 12 pts. 9,783
  2. Avatar for wosser1 62. wosser1 Lv 1 12 pts. 9,727
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 11 pts. 9,673
  4. Avatar for j.wohlmann 64. j.wohlmann Lv 1 11 pts. 9,632
  5. Avatar for carxo 65. carxo Lv 1 10 pts. 9,611
  6. Avatar for frostschutz 66. frostschutz Lv 1 10 pts. 9,585
  7. Avatar for zackallen 67. zackallen Lv 1 10 pts. 9,575
  8. Avatar for Larini 68. Larini Lv 1 9 pts. 9,554
  9. Avatar for Sciren 69. Sciren Lv 1 9 pts. 9,515
  10. Avatar for TokyoTF 70. TokyoTF Lv 1 8 pts. 9,514

Comments