Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365
  1. Avatar for georg137 21. georg137 Lv 1 22 pts. 27,946
  2. Avatar for alcor29 22. alcor29 Lv 1 20 pts. 27,927
  3. Avatar for dizzywings 23. dizzywings Lv 1 19 pts. 27,869
  4. Avatar for fpc 24. fpc Lv 1 17 pts. 27,817
  5. Avatar for Merf 25. Merf Lv 1 15 pts. 27,805
  6. Avatar for jobo0502 26. jobo0502 Lv 1 14 pts. 27,774
  7. Avatar for bamh 27. bamh Lv 1 13 pts. 27,718
  8. Avatar for maithra 28. maithra Lv 1 12 pts. 27,701
  9. Avatar for equilibria 29. equilibria Lv 1 11 pts. 27,657
  10. Avatar for Mike Cassidy 30. Mike Cassidy Lv 1 10 pts. 27,495

Comments