Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365
  1. Avatar for akaaka 31. akaaka Lv 1 9 pts. 27,472
  2. Avatar for phi16 32. phi16 Lv 1 8 pts. 27,459
  3. Avatar for infjamc 33. infjamc Lv 1 7 pts. 27,322
  4. Avatar for Blipperman 34. Blipperman Lv 1 6 pts. 27,310
  5. Avatar for NeLikomSheet 35. NeLikomSheet Lv 1 6 pts. 27,310
  6. Avatar for rezaefar 36. rezaefar Lv 1 5 pts. 27,301
  7. Avatar for Visok 37. Visok Lv 1 5 pts. 27,138
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 4 pts. 27,137
  9. Avatar for Idiotboy 39. Idiotboy Lv 1 4 pts. 27,004
  10. Avatar for zackallen 40. zackallen Lv 1 3 pts. 26,965

Comments