Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365
  1. Avatar for kyoota 41. kyoota Lv 1 3 pts. 26,941
  2. Avatar for Oransche 42. Oransche Lv 1 3 pts. 26,911
  3. Avatar for Trajan464 43. Trajan464 Lv 1 2 pts. 26,638
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 2 pts. 26,556
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 26,544
  6. Avatar for tracybutt 46. tracybutt Lv 1 2 pts. 26,500
  7. Avatar for Larini 47. Larini Lv 1 1 pt. 26,485
  8. Avatar for spvincent 48. spvincent Lv 1 1 pt. 26,416
  9. Avatar for AlkiP0Ps 49. AlkiP0Ps Lv 1 1 pt. 26,413
  10. Avatar for fiendish_ghoul 50. fiendish_ghoul Lv 1 1 pt. 26,287

Comments