Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365

  1. Avatar for Swapper242 61. Swapper242 Lv 1 1 pt. 25,284
  2. Avatar for Beany 62. Beany Lv 1 1 pt. 25,086
  3. Avatar for jamiexq 63. jamiexq Lv 1 1 pt. 25,029
  4. Avatar for sgeldhof 64. sgeldhof Lv 1 1 pt. 24,695
  5. Avatar for Stephanie Y_X401 65. Stephanie Y_X401 Lv 1 1 pt. 2,365
  6. Avatar for agcohn821 66. agcohn821 Lv 1 1 pt. 2,365
  7. Avatar for Lotus23 67. Lotus23 Lv 1 1 pt. 2,365
  8. Avatar for Tehnologik1 68. Tehnologik1 Lv 1 1 pt. 2,365
  9. Avatar for spdenne 69. spdenne Lv 1 1 pt. 2,365
  10. Avatar for NPrincipi 70. NPrincipi Lv 1 1 pt. 2,365

Comments