Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 28,663
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 28,597
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 28,597
  4. Avatar for Contenders 4. Contenders 21 pts. 28,390
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 28,191
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,171
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 27,869
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 27,774
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 27,495
  10. Avatar for VeFold 10. VeFold 1 pt. 26,556
  1. Avatar for SloppyPuppy 71. SloppyPuppy Lv 1 1 pt. 2,365
  2. Avatar for Keresto 72. Keresto Lv 1 1 pt. 2,365
  3. Avatar for borattt 73. borattt Lv 1 1 pt. 2,365
  4. Avatar for lcahya 74. lcahya Lv 1 1 pt. 2,365
  5. Avatar for manu8170 75. manu8170 Lv 1 1 pt. 2,365
  6. Avatar for sakshamphul 76. sakshamphul Lv 1 1 pt. 2,365
  7. Avatar for Sciren 77. Sciren Lv 1 1 pt. 2,365

Comments