Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 28,663
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 28,597
  3. Avatar for Beta Folders 3. Beta Folders 37 pts. 28,597
  4. Avatar for Contenders 4. Contenders 21 pts. 28,390
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 28,191
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 28,171
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 27,869
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 1 pt. 27,774
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 27,495
  10. Avatar for VeFold 10. VeFold 1 pt. 26,556
  1. Avatar for Arthuriel 51. Arthuriel Lv 1 1 pt. 26,159
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 26,155
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 26,120
  4. Avatar for froschi2 54. froschi2 Lv 1 1 pt. 25,983
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 25,877
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 25,869
  7. Avatar for pfirth 57. pfirth Lv 1 1 pt. 25,754
  8. Avatar for NISMO 58. NISMO Lv 1 1 pt. 25,734
  9. Avatar for MythicalPingu 59. MythicalPingu Lv 1 1 pt. 25,466
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 25,300

Comments