Placeholder image of a protein
Icon representing a puzzle

2113: Revisiting Puzzle 115: Exocyst

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 5,843
  2. Avatar for BIOF215 12. BIOF215 1 pt. 5,843
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 5,843
  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 32 pts. 10,747
  2. Avatar for SirWill3 32. SirWill3 Lv 1 31 pts. 10,670
  3. Avatar for heather-1 33. heather-1 Lv 1 30 pts. 10,656
  4. Avatar for Visok 34. Visok Lv 1 29 pts. 10,656
  5. Avatar for akaaka 35. akaaka Lv 1 27 pts. 10,655
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 26 pts. 10,599
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 25 pts. 10,593
  8. Avatar for infjamc 38. infjamc Lv 1 24 pts. 10,588
  9. Avatar for NeLikomSheet 39. NeLikomSheet Lv 1 23 pts. 10,573
  10. Avatar for Merf 40. Merf Lv 1 22 pts. 10,556

Comments