Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289
  1. Avatar for Deleted player 91. Deleted player 1 pt. 8,784
  2. Avatar for p34t 92. p34t Lv 1 1 pt. 8,754
  3. Avatar for jbarnwell 93. jbarnwell Lv 1 1 pt. 8,746
  4. Avatar for LELE1964 94. LELE1964 Lv 1 1 pt. 8,680
  5. Avatar for Swapper242 95. Swapper242 Lv 1 1 pt. 8,656
  6. Avatar for furi0us 96. furi0us Lv 1 1 pt. 8,651
  7. Avatar for drumpeter18yrs9yrs 97. drumpeter18yrs9yrs Lv 1 1 pt. 8,641
  8. Avatar for Consumer of nucleotides 98. Consumer of nucleotides Lv 1 1 pt. 8,627
  9. Avatar for evifnoskcaj 99. evifnoskcaj Lv 1 1 pt. 8,626
  10. Avatar for artsyambie6 100. artsyambie6 Lv 1 1 pt. 8,608

Comments