Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279
  1. Avatar for Deleted player 91. Deleted player 1 pt. 8,784
  2. Avatar for p34t 92. p34t Lv 1 1 pt. 8,754
  3. Avatar for jbarnwell 93. jbarnwell Lv 1 1 pt. 8,746
  4. Avatar for LELE1964 94. LELE1964 Lv 1 1 pt. 8,680
  5. Avatar for Swapper242 95. Swapper242 Lv 1 1 pt. 8,656
  6. Avatar for furi0us 96. furi0us Lv 1 1 pt. 8,651
  7. Avatar for drumpeter18yrs9yrs 97. drumpeter18yrs9yrs Lv 1 1 pt. 8,641
  8. Avatar for Consumer of nucleotides 98. Consumer of nucleotides Lv 1 1 pt. 8,627
  9. Avatar for evifnoskcaj 99. evifnoskcaj Lv 1 1 pt. 8,626
  10. Avatar for artsyambie6 100. artsyambie6 Lv 1 1 pt. 8,608

Comments