Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289
  1. Avatar for aliciaacosta 101. aliciaacosta Lv 1 1 pt. 8,548
  2. Avatar for Hebrew Hitman 102. Hebrew Hitman Lv 1 1 pt. 8,543
  3. Avatar for RockOn 103. RockOn Lv 1 1 pt. 8,431
  4. Avatar for GSolosky 104. GSolosky Lv 1 1 pt. 8,331
  5. Avatar for Savoc 105. Savoc Lv 1 1 pt. 8,000
  6. Avatar for cbwest 106. cbwest Lv 1 1 pt. 7,969
  7. Avatar for wmccl5204 107. wmccl5204 Lv 1 1 pt. 7,958
  8. Avatar for Cassidy1 108. Cassidy1 Lv 1 1 pt. 7,888
  9. Avatar for weatherman 109. weatherman Lv 1 1 pt. 7,848
  10. Avatar for 01010011111 110. 01010011111 Lv 1 1 pt. 7,786

Comments