Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,780
  2. Avatar for Contenders 2. Contenders 73 pts. 9,777
  3. Avatar for Go Science 3. Go Science 52 pts. 9,772
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,768
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 9,760
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 9,726
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,692
  8. Avatar for ProWigglers-AKLab 8. ProWigglers-AKLab 6 pts. 9,541
  9. Avatar for Australia 9. Australia 4 pts. 9,468
  10. Avatar for Ogre's lab 10. Ogre's lab 2 pts. 9,279
  1. Avatar for aliciaacosta 101. aliciaacosta Lv 1 1 pt. 8,548
  2. Avatar for Hebrew Hitman 102. Hebrew Hitman Lv 1 1 pt. 8,543
  3. Avatar for RockOn 103. RockOn Lv 1 1 pt. 8,431
  4. Avatar for GSolosky 104. GSolosky Lv 1 1 pt. 8,331
  5. Avatar for Savoc 105. Savoc Lv 1 1 pt. 8,000
  6. Avatar for cbwest 106. cbwest Lv 1 1 pt. 7,969
  7. Avatar for wmccl5204 107. wmccl5204 Lv 1 1 pt. 7,958
  8. Avatar for Cassidy1 108. Cassidy1 Lv 1 1 pt. 7,888
  9. Avatar for weatherman 109. weatherman Lv 1 1 pt. 7,848
  10. Avatar for 01010011111 110. 01010011111 Lv 1 1 pt. 7,786

Comments