Placeholder image of a protein
Icon representing a puzzle

2116: Revisiting Puzzle 117: Transport Mutant

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 03, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 9,133
  2. Avatar for Void Crushers 12. Void Crushers 1 pt. 9,069
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 7,701
  4. Avatar for Window Group 14. Window Group 1 pt. 7,387
  5. Avatar for Haykapnayan 15. Haykapnayan 1 pt. 6,321
  6. Avatar for G1051331 16. G1051331 1 pt. 6,130
  7. Avatar for UML BMEN.4100 17. UML BMEN.4100 1 pt. 1,289

  1. Avatar for Lotus23 31. Lotus23 Lv 1 29 pts. 9,643
  2. Avatar for Oransche 32. Oransche Lv 1 28 pts. 9,640
  3. Avatar for maithra 33. maithra Lv 1 26 pts. 9,640
  4. Avatar for BarrySampson 34. BarrySampson Lv 1 25 pts. 9,620
  5. Avatar for equilibria 35. equilibria Lv 1 24 pts. 9,617
  6. Avatar for kyoota 36. kyoota Lv 1 23 pts. 9,606
  7. Avatar for PeterDav 37. PeterDav Lv 1 22 pts. 9,592
  8. Avatar for NeLikomSheet 38. NeLikomSheet Lv 1 21 pts. 9,587
  9. Avatar for fiendish_ghoul 39. fiendish_ghoul Lv 1 20 pts. 9,586
  10. Avatar for infjamc 40. infjamc Lv 1 19 pts. 9,585

Comments