Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 11,063
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 11,018
  3. Avatar for robgee 3. robgee Lv 1 92 pts. 10,960
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 88 pts. 10,934
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 84 pts. 10,903
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 80 pts. 10,887
  7. Avatar for guineapig 7. guineapig Lv 1 76 pts. 10,867
  8. Avatar for frood66 8. frood66 Lv 1 72 pts. 10,837
  9. Avatar for jobo0502 9. jobo0502 Lv 1 69 pts. 10,822
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 66 pts. 10,808

Comments