Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Go Science 100 pts. 11,090
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,020
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,984
  4. Avatar for Contenders 4. Contenders 36 pts. 10,903
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,837
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,822
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,728
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,711
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 10,376
  10. Avatar for AlphaFold 10. AlphaFold 2 pts. 10,327

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 11,063
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 11,018
  3. Avatar for robgee 3. robgee Lv 1 92 pts. 10,960
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 88 pts. 10,934
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 84 pts. 10,903
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 80 pts. 10,887
  7. Avatar for guineapig 7. guineapig Lv 1 76 pts. 10,867
  8. Avatar for frood66 8. frood66 Lv 1 72 pts. 10,837
  9. Avatar for jobo0502 9. jobo0502 Lv 1 69 pts. 10,822
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 66 pts. 10,808

Comments