Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Go Science 100 pts. 11,090
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,020
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,984
  4. Avatar for Contenders 4. Contenders 36 pts. 10,903
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,837
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,822
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,728
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,711
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 10,376
  10. Avatar for AlphaFold 10. AlphaFold 2 pts. 10,327

  1. Avatar for cbwest 91. cbwest Lv 1 1 pt. 9,022
  2. Avatar for Zosa 92. Zosa Lv 1 1 pt. 8,919
  3. Avatar for aka_bkoep 93. aka_bkoep Lv 1 1 pt. 8,914
  4. Avatar for bkoep 94. bkoep Lv 1 1 pt. 8,638
  5. Avatar for HuyPham 95. HuyPham Lv 1 1 pt. 8,230
  6. Avatar for jflat06 96. jflat06 Lv 1 1 pt. 8,210
  7. Avatar for lezhe 97. lezhe Lv 1 1 pt. 8,174
  8. Avatar for mayacool4 99. mayacool4 Lv 1 1 pt. 8,165
  9. Avatar for altejoh 100. altejoh Lv 1 1 pt. 8,165

Comments