Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Go Science 100 pts. 11,090
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,020
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,984
  4. Avatar for Contenders 4. Contenders 36 pts. 10,903
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,837
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,822
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,728
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,711
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 10,376
  10. Avatar for AlphaFold 10. AlphaFold 2 pts. 10,327

  1. Avatar for tracybutt 61. tracybutt Lv 1 2 pts. 9,923
  2. Avatar for AlkiP0Ps 62. AlkiP0Ps Lv 1 2 pts. 9,910
  3. Avatar for Simek 63. Simek Lv 1 2 pts. 9,902
  4. Avatar for katling 64. katling Lv 1 2 pts. 9,872
  5. Avatar for Dr.Sillem 65. Dr.Sillem Lv 1 2 pts. 9,862
  6. Avatar for zackallen 66. zackallen Lv 1 2 pts. 9,853
  7. Avatar for froschi2 67. froschi2 Lv 1 2 pts. 9,792
  8. Avatar for techy cat 68. techy cat Lv 1 1 pt. 9,743
  9. Avatar for abiogenesis 69. abiogenesis Lv 1 1 pt. 9,687
  10. Avatar for Hellcat6 70. Hellcat6 Lv 1 1 pt. 9,639

Comments