Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since almost 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 19,413
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 19,413
  3. Avatar for Go Science 3. Go Science 52 pts. 19,385
  4. Avatar for Contenders 4. Contenders 36 pts. 19,385
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 19,305
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 19,261
  7. Avatar for VeFold 7. VeFold 10 pts. 19,174
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 19,141
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 19,141
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 19,070
  1. Avatar for Anfinsen_slept_here 31. Anfinsen_slept_here Lv 1 12 pts. 19,142
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 11 pts. 19,141
  3. Avatar for spongiformasquarepantsii 33. spongiformasquarepantsii Lv 1 10 pts. 19,141
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 9 pts. 19,120
  5. Avatar for akaaka 35. akaaka Lv 1 9 pts. 19,110
  6. Avatar for NeLikomSheet 36. NeLikomSheet Lv 1 8 pts. 19,098
  7. Avatar for jobo0502 37. jobo0502 Lv 1 7 pts. 19,070
  8. Avatar for Blipperman 38. Blipperman Lv 1 7 pts. 19,041
  9. Avatar for manu8170 39. manu8170 Lv 1 6 pts. 19,036
  10. Avatar for Lotus23 40. Lotus23 Lv 1 5 pts. 18,999

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.