Placeholder image of a protein
Icon representing a puzzle

2120: Electron Density Reconstruction 6

Closed since almost 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
March 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 19,413
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 19,413
  3. Avatar for Go Science 3. Go Science 52 pts. 19,385
  4. Avatar for Contenders 4. Contenders 36 pts. 19,385
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 19,305
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 19,261
  7. Avatar for VeFold 7. VeFold 10 pts. 19,174
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 6 pts. 19,141
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 19,141
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 19,070
  1. Avatar for Beany 51. Beany Lv 1 2 pts. 18,801
  2. Avatar for ProfVince 52. ProfVince Lv 1 2 pts. 18,768
  3. Avatar for Franco Padelletti 53. Franco Padelletti Lv 1 1 pt. 18,665
  4. Avatar for Dr.Sillem 54. Dr.Sillem Lv 1 1 pt. 18,635
  5. Avatar for kyoota 55. kyoota Lv 1 1 pt. 18,570
  6. Avatar for HuubR 56. HuubR Lv 1 1 pt. 18,565
  7. Avatar for Punzi Baker 3 57. Punzi Baker 3 Lv 1 1 pt. 18,548
  8. Avatar for rinze 58. rinze Lv 1 1 pt. 18,500
  9. Avatar for froschi2 59. froschi2 Lv 1 1 pt. 18,495
  10. Avatar for pruneau_44 60. pruneau_44 Lv 1 1 pt. 18,490

Comments

LociOiling Lv 1

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.