Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 9,347
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,985
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 8,877
  4. Avatar for G1051331 14. G1051331 1 pt. 8,404
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,315
  6. Avatar for Window Group 16. Window Group 1 pt. 8,126
  7. Avatar for SHELL 17. SHELL 1 pt. 7,023
  8. Avatar for test 2 18. test 2 1 pt. 6,488
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,178
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 96 pts. 10,174
  3. Avatar for gmn 3. gmn Lv 1 92 pts. 10,168
  4. Avatar for Galaxie 4. Galaxie Lv 1 88 pts. 10,159
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 84 pts. 10,155
  6. Avatar for MicElephant 6. MicElephant Lv 1 80 pts. 10,150
  7. Avatar for jobo0502 7. jobo0502 Lv 1 76 pts. 10,148
  8. Avatar for robgee 8. robgee Lv 1 73 pts. 10,122
  9. Avatar for fpc 9. fpc Lv 1 69 pts. 10,120
  10. Avatar for BarrySampson 10. BarrySampson Lv 1 66 pts. 10,117

Comments