Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,178
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 96 pts. 10,174
  3. Avatar for gmn 3. gmn Lv 1 92 pts. 10,168
  4. Avatar for Galaxie 4. Galaxie Lv 1 88 pts. 10,159
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 84 pts. 10,155
  6. Avatar for MicElephant 6. MicElephant Lv 1 80 pts. 10,150
  7. Avatar for jobo0502 7. jobo0502 Lv 1 76 pts. 10,148
  8. Avatar for robgee 8. robgee Lv 1 73 pts. 10,122
  9. Avatar for fpc 9. fpc Lv 1 69 pts. 10,120
  10. Avatar for BarrySampson 10. BarrySampson Lv 1 66 pts. 10,117

Comments