Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 9,347
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,985
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 8,877
  4. Avatar for G1051331 14. G1051331 1 pt. 8,404
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,315
  6. Avatar for Window Group 16. Window Group 1 pt. 8,126
  7. Avatar for SHELL 17. SHELL 1 pt. 7,023
  8. Avatar for test 2 18. test 2 1 pt. 6,488
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,174
  2. Avatar for Galaxie 2. Galaxie Lv 1 65 pts. 10,171
  3. Avatar for phi16 3. phi16 Lv 1 41 pts. 10,161
  4. Avatar for MicElephant 4. MicElephant Lv 1 24 pts. 10,153
  5. Avatar for guineapig 5. guineapig Lv 1 14 pts. 10,150
  6. Avatar for gmn 6. gmn Lv 1 7 pts. 10,139
  7. Avatar for robgee 7. robgee Lv 1 4 pts. 10,133
  8. Avatar for alcor29 8. alcor29 Lv 1 2 pts. 10,118
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 1 pt. 10,111
  10. Avatar for Beany 10. Beany Lv 1 1 pt. 10,089

Comments