Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549

  1. Avatar for jsfoldingaccount 41. jsfoldingaccount Lv 1 11 pts. 9,928
  2. Avatar for kyoota 42. kyoota Lv 1 10 pts. 9,928
  3. Avatar for equilibria 43. equilibria Lv 1 10 pts. 9,919
  4. Avatar for dizzywings 44. dizzywings Lv 1 9 pts. 9,907
  5. Avatar for alcor29 45. alcor29 Lv 1 9 pts. 9,903
  6. Avatar for AlphaFold2 46. AlphaFold2 Lv 1 8 pts. 9,902
  7. Avatar for Oransche 47. Oransche Lv 1 7 pts. 9,888
  8. Avatar for Skippysk8s 48. Skippysk8s Lv 1 7 pts. 9,887
  9. Avatar for Vinara 49. Vinara Lv 1 6 pts. 9,867
  10. Avatar for zippyc137 50. zippyc137 Lv 1 6 pts. 9,855

Comments