Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,178
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,171
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 10,148
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,120
  5. Avatar for Go Science 5. Go Science 27 pts. 10,113
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,111
  7. Avatar for Contenders 7. Contenders 12 pts. 10,081
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,002
  9. Avatar for AlphaFold 9. AlphaFold 5 pts. 9,902
  10. Avatar for Australia 10. Australia 3 pts. 9,549

  1. Avatar for LeoClaxton 81. LeoClaxton Lv 1 1 pt. 9,140
  2. Avatar for Deleted player 82. Deleted player 1 pt. 9,126
  3. Avatar for DScott 83. DScott Lv 1 1 pt. 9,110
  4. Avatar for hada 84. hada Lv 1 1 pt. 9,091
  5. Avatar for Hebrew Hitman 85. Hebrew Hitman Lv 1 1 pt. 9,065
  6. Avatar for dierese 86. dierese Lv 1 1 pt. 9,039
  7. Avatar for Prion_research 87. Prion_research Lv 1 1 pt. 9,033
  8. Avatar for Savas 88. Savas Lv 1 1 pt. 8,985
  9. Avatar for Amynet 89. Amynet Lv 1 1 pt. 8,975
  10. Avatar for Simek 90. Simek Lv 1 1 pt. 8,974

Comments