Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,309
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,103
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,580
  4. Avatar for BioCentric 14. BioCentric 1 pt. 8,161
  5. Avatar for Team China 15. Team China 1 pt. 7,916
  6. Avatar for OmHS 16. OmHS 1 pt. 7,720
  7. Avatar for SHELL 17. SHELL 1 pt. 7,646
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,900
  9. Avatar for test_group1 19. test_group1 1 pt. 0
  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 30 pts. 10,069
  2. Avatar for Phyx 32. Phyx Lv 1 29 pts. 10,031
  3. Avatar for fpc 33. fpc Lv 1 28 pts. 9,953
  4. Avatar for NeLikomSheet 34. NeLikomSheet Lv 1 27 pts. 9,948
  5. Avatar for zippyc137 35. zippyc137 Lv 1 25 pts. 9,917
  6. Avatar for Vinara 36. Vinara Lv 1 24 pts. 9,903
  7. Avatar for abiogenesis 37. abiogenesis Lv 1 23 pts. 9,894
  8. Avatar for Skippysk8s 38. Skippysk8s Lv 1 22 pts. 9,872
  9. Avatar for AlphaFold2 39. AlphaFold2 Lv 1 21 pts. 9,872
  10. Avatar for bamh 40. bamh Lv 1 20 pts. 9,861

Comments