Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,877
  2. Avatar for Contenders 2. Contenders 76 pts. 10,777
  3. Avatar for Go Science 3. Go Science 56 pts. 10,720
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,455
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 10,130
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,872
  8. Avatar for Beta Folders 8. Beta Folders 9 pts. 9,777
  9. Avatar for Coastal Biochemistry 9. Coastal Biochemistry 6 pts. 9,418
  10. Avatar for Australia 10. Australia 4 pts. 9,371
  1. Avatar for WBarme1234 31. WBarme1234 Lv 1 30 pts. 10,069
  2. Avatar for Phyx 32. Phyx Lv 1 29 pts. 10,031
  3. Avatar for fpc 33. fpc Lv 1 28 pts. 9,953
  4. Avatar for NeLikomSheet 34. NeLikomSheet Lv 1 27 pts. 9,948
  5. Avatar for zippyc137 35. zippyc137 Lv 1 25 pts. 9,917
  6. Avatar for Vinara 36. Vinara Lv 1 24 pts. 9,903
  7. Avatar for abiogenesis 37. abiogenesis Lv 1 23 pts. 9,894
  8. Avatar for Skippysk8s 38. Skippysk8s Lv 1 22 pts. 9,872
  9. Avatar for AlphaFold2 39. AlphaFold2 Lv 1 21 pts. 9,872
  10. Avatar for bamh 40. bamh Lv 1 20 pts. 9,861

Comments