Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for GENE 433 11. GENE 433 3 pts. 8,995
  2. Avatar for Void Crushers 12. Void Crushers 2 pts. 8,967
  3. Avatar for Team China 13. Team China 1 pt. 8,961
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,515
  5. Avatar for Ogre's lab 15. Ogre's lab 1 pt. 8,234
  6. Avatar for Beta Folders 16. Beta Folders 1 pt. 8,133
  7. Avatar for Window Group 17. Window Group 1 pt. 6,474
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,351
  9. Avatar for Haykapnayan 19. Haykapnayan 1 pt. 5,351
  10. Avatar for test_group1 20. test_group1 1 pt. 5,351
  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 4 pts. 9,039
  2. Avatar for ppp6 62. ppp6 Lv 1 4 pts. 9,038
  3. Avatar for treyher 63. treyher Lv 1 4 pts. 9,036
  4. Avatar for AlkiP0Ps 64. AlkiP0Ps Lv 1 4 pts. 9,033
  5. Avatar for Wiz kid 65. Wiz kid Lv 1 3 pts. 9,015
  6. Avatar for Cagdason 66. Cagdason Lv 1 3 pts. 8,995
  7. Avatar for Zosa 67. Zosa Lv 1 3 pts. 8,979
  8. Avatar for Simek 68. Simek Lv 1 3 pts. 8,967
  9. Avatar for Arne Heessels 69. Arne Heessels Lv 1 2 pts. 8,963
  10. Avatar for cymic 70. cymic Lv 1 2 pts. 8,961

Comments