Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,864
  2. Avatar for Go Science 2. Go Science 77 pts. 9,719
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 9,686
  4. Avatar for Contenders 4. Contenders 43 pts. 9,679
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,639
  6. Avatar for AlphaFold 6. AlphaFold 22 pts. 9,637
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,623
  8. Avatar for BOINC@Poland 8. BOINC@Poland 11 pts. 9,241
  9. Avatar for BioCentric 9. BioCentric 7 pts. 9,036
  10. Avatar for Australia 10. Australia 5 pts. 9,033

  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 4 pts. 9,039
  2. Avatar for ppp6 62. ppp6 Lv 1 4 pts. 9,038
  3. Avatar for treyher 63. treyher Lv 1 4 pts. 9,036
  4. Avatar for AlkiP0Ps 64. AlkiP0Ps Lv 1 4 pts. 9,033
  5. Avatar for Wiz kid 65. Wiz kid Lv 1 3 pts. 9,015
  6. Avatar for Cagdason 66. Cagdason Lv 1 3 pts. 8,995
  7. Avatar for Zosa 67. Zosa Lv 1 3 pts. 8,979
  8. Avatar for Simek 68. Simek Lv 1 3 pts. 8,967
  9. Avatar for Arne Heessels 69. Arne Heessels Lv 1 2 pts. 8,963
  10. Avatar for cymic 70. cymic Lv 1 2 pts. 8,961

Comments