Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,864
  2. Avatar for Go Science 2. Go Science 77 pts. 9,719
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 9,686
  4. Avatar for Contenders 4. Contenders 43 pts. 9,679
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,639
  6. Avatar for AlphaFold 6. AlphaFold 22 pts. 9,637
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,623
  8. Avatar for BOINC@Poland 8. BOINC@Poland 11 pts. 9,241
  9. Avatar for BioCentric 9. BioCentric 7 pts. 9,036
  10. Avatar for Australia 10. Australia 5 pts. 9,033
  1. Avatar for karmeitha 111. karmeitha Lv 1 1 pt. 5,501
  2. Avatar for wwvigil2 112. wwvigil2 Lv 1 1 pt. 5,431
  3. Avatar for Silver_Fire 113. Silver_Fire Lv 1 1 pt. 5,406
  4. Avatar for tiagolf 114. tiagolf Lv 1 1 pt. 5,352
  5. Avatar for zo3xiaJonWeinberg 115. zo3xiaJonWeinberg Lv 1 1 pt. 5,351
  6. Avatar for Sciren 116. Sciren Lv 1 1 pt. 5,351
  7. Avatar for PLM.CHY2202.BLK4.G8.AY2021.22.S2 117. PLM.CHY2202.BLK4.G8.AY2021.22.S2 Lv 1 1 pt. 5,351
  8. Avatar for PLM.CHY2202.BLK4.G6.AY2021.22.S2 118. PLM.CHY2202.BLK4.G6.AY2021.22.S2 Lv 1 1 pt. 5,351
  9. Avatar for test_account1 119. test_account1 Lv 1 1 pt. 5,351
  10. Avatar for masterkoster 120. masterkoster Lv 1 1 pt. 5,351

Comments