Placeholder image of a protein
Icon representing a puzzle

2131: Revisiting Puzzle 135: E. coli

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 07, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,864
  2. Avatar for Go Science 2. Go Science 77 pts. 9,719
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 9,686
  4. Avatar for Contenders 4. Contenders 43 pts. 9,679
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 9,639
  6. Avatar for AlphaFold 6. AlphaFold 22 pts. 9,637
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,623
  8. Avatar for BOINC@Poland 8. BOINC@Poland 11 pts. 9,241
  9. Avatar for BioCentric 9. BioCentric 7 pts. 9,036
  10. Avatar for Australia 10. Australia 5 pts. 9,033
  1. Avatar for pruneau_44 91. pruneau_44 Lv 1 1 pt. 7,819
  2. Avatar for CAN1958 92. CAN1958 Lv 1 1 pt. 7,802
  3. Avatar for BearMagistr 93. BearMagistr Lv 1 1 pt. 7,794
  4. Avatar for Deleted player 94. Deleted player pts. 7,739
  5. Avatar for Alex333 95. Alex333 Lv 1 1 pt. 7,670
  6. Avatar for Mohoernchen 96. Mohoernchen Lv 1 1 pt. 7,655
  7. Avatar for 4.5billion 97. 4.5billion Lv 1 1 pt. 7,651
  8. Avatar for kludbrook 98. kludbrook Lv 1 1 pt. 7,643
  9. Avatar for Josef_2021 99. Josef_2021 Lv 1 1 pt. 7,630
  10. Avatar for Hebrew Hitman 100. Hebrew Hitman Lv 1 1 pt. 7,561

Comments