Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091

  1. Avatar for MrZanav 91. MrZanav Lv 1 1 pt. 6,595
  2. Avatar for helena_sbs 92. helena_sbs Lv 1 1 pt. 5,126
  3. Avatar for ArielvanB 93. ArielvanB Lv 1 1 pt. 5,126
  4. Avatar for Nik18Vas 94. Nik18Vas Lv 1 1 pt. 5,104
  5. Avatar for frood66 95. frood66 Lv 1 1 pt. 5,103
  6. Avatar for sokk 96. sokk Lv 1 1 pt. 5,092
  7. Avatar for JosueR 98. JosueR Lv 1 1 pt. 5,091
  8. Avatar for 41922092 99. 41922092 Lv 1 1 pt. 5,091
  9. Avatar for kylaloouuu 100. kylaloouuu Lv 1 1 pt. 5,091

Comments