Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for par.raq.2001 101. par.raq.2001 Lv 1 1 pt. 5,091
  2. Avatar for PLMCHM3213BLK1G5AY202122S2 102. PLMCHM3213BLK1G5AY202122S2 Lv 1 1 pt. 5,091
  3. Avatar for PLMCHM3213BLK1G1AY202122S2 103. PLMCHM3213BLK1G1AY202122S2 Lv 1 1 pt. 5,091
  4. Avatar for ustb_U202140537 104. ustb_U202140537 Lv 1 1 pt. 5,091
  5. Avatar for joshmiller 105. joshmiller Lv 1 1 pt. 5,091
  6. Avatar for pfirth 106. pfirth Lv 1 1 pt. 5,091
  7. Avatar for Sciren 107. Sciren Lv 1 1 pt. 5,091

Comments