Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for Galaxie 11. Galaxie Lv 1 61 pts. 9,860
  2. Avatar for MicElephant 12. MicElephant Lv 1 58 pts. 9,859
  3. Avatar for borattt 13. borattt Lv 1 55 pts. 9,856
  4. Avatar for gmn 14. gmn Lv 1 52 pts. 9,836
  5. Avatar for fiendish_ghoul 15. fiendish_ghoul Lv 1 50 pts. 9,827
  6. Avatar for fpc 16. fpc Lv 1 47 pts. 9,819
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 45 pts. 9,806
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 42 pts. 9,791
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 40 pts. 9,754
  10. Avatar for Idiotboy 20. Idiotboy Lv 1 38 pts. 9,750

Comments