Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091

  1. Avatar for akaaka 21. akaaka Lv 1 36 pts. 9,724
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 34 pts. 9,724
  3. Avatar for jausmh 23. jausmh Lv 1 32 pts. 9,711
  4. Avatar for g_b 24. g_b Lv 1 30 pts. 9,660
  5. Avatar for NeLikomSheet 25. NeLikomSheet Lv 1 28 pts. 9,644
  6. Avatar for Lotus23 26. Lotus23 Lv 1 27 pts. 9,622
  7. Avatar for ProfVince 27. ProfVince Lv 1 25 pts. 9,583
  8. Avatar for zippyc137 28. zippyc137 Lv 1 23 pts. 9,562
  9. Avatar for dizzywings 29. dizzywings Lv 1 22 pts. 9,536
  10. Avatar for stomjoh 30. stomjoh Lv 1 21 pts. 9,524

Comments