Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for heather-1 31. heather-1 Lv 1 19 pts. 9,518
  2. Avatar for alcor29 32. alcor29 Lv 1 18 pts. 9,482
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 17 pts. 9,454
  4. Avatar for infjamc 34. infjamc Lv 1 16 pts. 9,446
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 15 pts. 9,445
  6. Avatar for Deleted player 36. Deleted player pts. 9,406
  7. Avatar for maithra 37. maithra Lv 1 13 pts. 9,330
  8. Avatar for WBarme1234 38. WBarme1234 Lv 1 12 pts. 9,303
  9. Avatar for Oransche 39. Oransche Lv 1 11 pts. 9,276
  10. Avatar for equilibria 40. equilibria Lv 1 11 pts. 9,267

Comments