Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for Pazithi 41. Pazithi Lv 1 10 pts. 9,264
  2. Avatar for RockOn 42. RockOn Lv 1 9 pts. 9,120
  3. Avatar for drumpeter18yrs9yrs 43. drumpeter18yrs9yrs Lv 1 9 pts. 9,097
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 8 pts. 9,095
  5. Avatar for carxo 45. carxo Lv 1 7 pts. 9,076
  6. Avatar for Simek 46. Simek Lv 1 7 pts. 9,062
  7. Avatar for phi16 47. phi16 Lv 1 6 pts. 9,022
  8. Avatar for NPrincipi 48. NPrincipi Lv 1 6 pts. 8,982
  9. Avatar for TheGUmmer 49. TheGUmmer Lv 1 5 pts. 8,927
  10. Avatar for Merf 50. Merf Lv 1 5 pts. 8,917

Comments