Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for RWoodcock 51. RWoodcock Lv 1 5 pts. 8,886
  2. Avatar for PeterDav 52. PeterDav Lv 1 4 pts. 8,865
  3. Avatar for Deleted player 53. Deleted player 4 pts. 8,851
  4. Avatar for zackallen 54. zackallen Lv 1 4 pts. 8,831
  5. Avatar for Larini 55. Larini Lv 1 3 pts. 8,745
  6. Avatar for shettler 56. shettler Lv 1 3 pts. 8,605
  7. Avatar for Crossed Sticks 57. Crossed Sticks Lv 1 3 pts. 8,570
  8. Avatar for antibot215 58. antibot215 Lv 1 3 pts. 8,556
  9. Avatar for bamh 59. bamh Lv 1 2 pts. 8,549
  10. Avatar for tracybutt 60. tracybutt Lv 1 2 pts. 8,527

Comments