Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091

  1. Avatar for Vinara 61. Vinara Lv 1 2 pts. 8,523
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 2 pts. 8,479
  3. Avatar for Alistair69 63. Alistair69 Lv 1 2 pts. 8,432
  4. Avatar for Cagdason 64. Cagdason Lv 1 2 pts. 8,392
  5. Avatar for jburton83 65. jburton83 Lv 1 1 pt. 8,328
  6. Avatar for Trajan464 66. Trajan464 Lv 1 1 pt. 8,305
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 1 pt. 8,280
  8. Avatar for AlkiP0Ps 68. AlkiP0Ps Lv 1 1 pt. 8,276
  9. Avatar for abiogenesis 69. abiogenesis Lv 1 1 pt. 8,276
  10. Avatar for Wiz kid 70. Wiz kid Lv 1 1 pt. 8,235

Comments