Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,078
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 9,991
  3. Avatar for Go Science 3. Go Science 49 pts. 9,950
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,894
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,819
  6. Avatar for Contenders 6. Contenders 14 pts. 9,806
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,095
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,062
  9. Avatar for Beta Folders 9. Beta Folders 3 pts. 8,527
  10. Avatar for GENE 433 10. GENE 433 2 pts. 8,392
  1. Avatar for kitsoune 71. kitsoune Lv 1 1 pt. 8,217
  2. Avatar for Keresto 72. Keresto Lv 1 1 pt. 8,191
  3. Avatar for cjddig 73. cjddig Lv 1 1 pt. 8,089
  4. Avatar for rinze 74. rinze Lv 1 1 pt. 8,063
  5. Avatar for pruneau_44 75. pruneau_44 Lv 1 1 pt. 8,044
  6. Avatar for Maximus150 76. Maximus150 Lv 1 1 pt. 8,043
  7. Avatar for Griffinfx_ 77. Griffinfx_ Lv 1 1 pt. 8,028
  8. Avatar for jamiexq 78. jamiexq Lv 1 1 pt. 8,006
  9. Avatar for imgil25 79. imgil25 Lv 1 1 pt. 7,980
  10. Avatar for Beany 80. Beany Lv 1 1 pt. 7,920

Comments