Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,078
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 9,991
  3. Avatar for Go Science 3. Go Science 49 pts. 9,950
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 9,894
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 9,819
  6. Avatar for Contenders 6. Contenders 14 pts. 9,806
  7. Avatar for AlphaFold 7. AlphaFold 8 pts. 9,095
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 9,062
  9. Avatar for Beta Folders 9. Beta Folders 3 pts. 8,527
  10. Avatar for GENE 433 10. GENE 433 2 pts. 8,392
  1. Avatar for kevin everington 81. kevin everington Lv 1 1 pt. 7,913
  2. Avatar for DScott 82. DScott Lv 1 1 pt. 7,885
  3. Avatar for kludbrook 83. kludbrook Lv 1 1 pt. 7,831
  4. Avatar for jsfoldingaccount 84. jsfoldingaccount Lv 1 1 pt. 7,658
  5. Avatar for Tyranus21 85. Tyranus21 Lv 1 1 pt. 7,587
  6. Avatar for furi0us 86. furi0us Lv 1 1 pt. 7,413
  7. Avatar for Anfinsen_slept_here 87. Anfinsen_slept_here Lv 1 1 pt. 7,364
  8. Avatar for Mohoernchen 88. Mohoernchen Lv 1 1 pt. 7,201
  9. Avatar for 41922093 89. 41922093 Lv 1 1 pt. 7,045
  10. Avatar for joshtest01 90. joshtest01 Lv 1 1 pt. 6,740

Comments