Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  1. Avatar for zackallen 41. zackallen Lv 1 7 pts. 15,510
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 6 pts. 15,447
  3. Avatar for NeLikomSheet 43. NeLikomSheet Lv 1 6 pts. 15,391
  4. Avatar for frood66 44. frood66 Lv 1 5 pts. 15,377
  5. Avatar for ProfVince 45. ProfVince Lv 1 5 pts. 15,371
  6. Avatar for equilibria 46. equilibria Lv 1 5 pts. 15,358
  7. Avatar for Merf 47. Merf Lv 1 4 pts. 15,261
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 4 pts. 15,230
  9. Avatar for carxo 49. carxo Lv 1 3 pts. 15,177
  10. Avatar for heather-1 50. heather-1 Lv 1 3 pts. 15,173

Comments