Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 16,734
  2. Avatar for Go Science 2. Go Science 68 pts. 16,695
  3. Avatar for Contenders 3. Contenders 44 pts. 16,651
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 16,572
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 16,462
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 16,239
  7. Avatar for Australia 7. Australia 5 pts. 15,674
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 15,230
  9. Avatar for VeFold 9. VeFold 1 pt. 15,177
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 14,390

  1. Avatar for zackallen 41. zackallen Lv 1 7 pts. 15,510
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 6 pts. 15,447
  3. Avatar for NeLikomSheet 43. NeLikomSheet Lv 1 6 pts. 15,391
  4. Avatar for frood66 44. frood66 Lv 1 5 pts. 15,377
  5. Avatar for ProfVince 45. ProfVince Lv 1 5 pts. 15,371
  6. Avatar for equilibria 46. equilibria Lv 1 5 pts. 15,358
  7. Avatar for Merf 47. Merf Lv 1 4 pts. 15,261
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 4 pts. 15,230
  9. Avatar for carxo 49. carxo Lv 1 3 pts. 15,177
  10. Avatar for heather-1 50. heather-1 Lv 1 3 pts. 15,173

Comments