Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  1. Avatar for Polarstern 71. Polarstern Lv 1 1 pt. 13,936
  2. Avatar for Mohoernchen 72. Mohoernchen Lv 1 1 pt. 13,803
  3. Avatar for pruneau_44 73. pruneau_44 Lv 1 1 pt. 13,791
  4. Avatar for kitsoune 74. kitsoune Lv 1 1 pt. 13,729
  5. Avatar for MizarTheMystic 75. MizarTheMystic Lv 1 1 pt. 13,655
  6. Avatar for zbp 76. zbp Lv 1 1 pt. 13,583
  7. Avatar for kevin everington 77. kevin everington Lv 1 1 pt. 13,474
  8. Avatar for rinze 78. rinze Lv 1 1 pt. 13,396
  9. Avatar for imgil25 79. imgil25 Lv 1 1 pt. 13,387
  10. Avatar for furi0us 80. furi0us Lv 1 1 pt. 12,930

Comments