Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 16,734
  2. Avatar for Go Science 2. Go Science 68 pts. 16,695
  3. Avatar for Contenders 3. Contenders 44 pts. 16,651
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 16,572
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 16,462
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 16,239
  7. Avatar for Australia 7. Australia 5 pts. 15,674
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 15,230
  9. Avatar for VeFold 9. VeFold 1 pt. 15,177
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 14,390

  1. Avatar for Polarstern 71. Polarstern Lv 1 1 pt. 13,936
  2. Avatar for Mohoernchen 72. Mohoernchen Lv 1 1 pt. 13,803
  3. Avatar for pruneau_44 73. pruneau_44 Lv 1 1 pt. 13,791
  4. Avatar for kitsoune 74. kitsoune Lv 1 1 pt. 13,729
  5. Avatar for MizarTheMystic 75. MizarTheMystic Lv 1 1 pt. 13,655
  6. Avatar for zbp 76. zbp Lv 1 1 pt. 13,583
  7. Avatar for kevin everington 77. kevin everington Lv 1 1 pt. 13,474
  8. Avatar for rinze 78. rinze Lv 1 1 pt. 13,396
  9. Avatar for imgil25 79. imgil25 Lv 1 1 pt. 13,387
  10. Avatar for furi0us 80. furi0us Lv 1 1 pt. 12,930

Comments