Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Beta Folders 11. Beta Folders 1 pt. 14,200
  2. Avatar for Window Group 12. Window Group 1 pt. 0
  3. Avatar for TISKEMI2 13. TISKEMI2 1 pt. 0
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  1. Avatar for north_zephyr 81. north_zephyr Lv 1 1 pt. 12,829
  2. Avatar for brandon sebastian 82. brandon sebastian Lv 1 1 pt. 11,542
  3. Avatar for mwm64 83. mwm64 Lv 1 1 pt. 10,367
  4. Avatar for Griffinfx_ 84. Griffinfx_ Lv 1 1 pt. 9,063
  5. Avatar for jflat06 85. jflat06 Lv 1 1 pt. 0
  6. Avatar for sdlerm 86. sdlerm Lv 1 1 pt. 0
  7. Avatar for plutopidge 87. plutopidge Lv 1 1 pt. 0
  8. Avatar for Susume 88. Susume Lv 1 1 pt. 0
  9. Avatar for haurulk 89. haurulk Lv 1 1 pt. 0
  10. Avatar for bkoep 90. bkoep Lv 1 1 pt. 0

Comments