Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 16,734
  2. Avatar for Go Science 2. Go Science 68 pts. 16,695
  3. Avatar for Contenders 3. Contenders 44 pts. 16,651
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 16,572
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 16,462
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 16,239
  7. Avatar for Australia 7. Australia 5 pts. 15,674
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 15,230
  9. Avatar for VeFold 9. VeFold 1 pt. 15,177
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 14,390

  1. Avatar for north_zephyr 81. north_zephyr Lv 1 1 pt. 12,829
  2. Avatar for brandon sebastian 82. brandon sebastian Lv 1 1 pt. 11,542
  3. Avatar for mwm64 83. mwm64 Lv 1 1 pt. 10,367
  4. Avatar for Griffinfx_ 84. Griffinfx_ Lv 1 1 pt. 9,063
  5. Avatar for jflat06 85. jflat06 Lv 1 1 pt. 0
  6. Avatar for plutopidge 86. plutopidge Lv 1 1 pt. 0
  7. Avatar for Susume 87. Susume Lv 1 1 pt. 0
  8. Avatar for sdlerm 88. sdlerm Lv 1 1 pt. 0
  9. Avatar for cfabs 89. cfabs Lv 1 1 pt. 0
  10. Avatar for haurulk 90. haurulk Lv 1 1 pt. 0

Comments